PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca60742.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NF-YB
Protein Properties Length: 295aa    MW: 32706.4 Da    PI: 4.3561
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca60742.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB133.75.6e-4212103495
       NF-YB   4 qdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                 +++++Pianv+rim+k++P++akis+ ak ++qe v+efi fvt+ea+d+c++e+r+ti+g+d+l+a+++l +++yvepl+ yl+kyre+eg
  Dca60742.1  12 EQQLVPIANVIRIMRKAVPQHAKISDGAKFSIQESVTEFIRFVTQEANDRCRKEHRRTITGEDILFAMGNLRLDNYVEPLTRYLQKYREFEG 103
                 56899*************************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.107.6E-3712105IPR009072Histone-fold
SuperFamilySSF471132.95E-3115107IPR009072Histone-fold
PfamPF008082.0E-211679IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.4E-144361No hitNo description
PRINTSPR006152.4E-146280No hitNo description
PRINTSPR006152.4E-148199No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MPPTTTMLPV SEQQLVPIAN VIRIMRKAVP QHAKISDGAK FSIQESVTEF IRFVTQEAND  60
RCRKEHRRTI TGEDILFAMG NLRLDNYVEP LTRYLQKYRE FEGLNHPHHQ LMGFMPRAAV  120
MVPPIMSPNF SNNANMFVDA TQQQQNYFTN YEPASSSSVA NMFVNATQQQ QNYFTNYEPV  180
SSSSVANMFV NATQQQQNYF SNYEPVSSSS SCDPPPAPAP ASAAYAMPSV PAQSEGLFSS  240
LMDSINFEGG SCCTENEVEF GSIQFPAGDD AASTSGSTSA SILDDELFDL FAQFE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4csr_A2e-31161001094NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4awl_B2e-31161001094NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.24e-37nuclear factor Y, subunit B6